Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 727094..727698 | Replicon | chromosome |
| Accession | NZ_CP117668 | ||
| Organism | Escherichia albertii strain BIA_11 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A8H9B4D1 |
| Locus tag | PS054_RS03805 | Protein ID | WP_059222236.1 |
| Coordinates | 727094..727480 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS054_RS03810 | Protein ID | WP_001195490.1 |
| Coordinates | 727477..727698 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS054_RS03795 (722378) | 722378..725878 | + | 3501 | WP_273814871.1 | ESPR-type extended signal peptide-containing protein | - |
| PS054_RS03800 (725992) | 725992..727092 | + | 1101 | WP_273814873.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| PS054_RS03805 (727094) | 727094..727480 | - | 387 | WP_059222236.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS054_RS03810 (727477) | 727477..727698 | - | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS054_RS03815 (728116) | 728116..728874 | + | 759 | WP_025239009.1 | trans-aconitate 2-methyltransferase | - |
| PS054_RS03820 (728878) | 728878..729792 | - | 915 | WP_024164792.1 | bestrophin family protein | - |
| PS054_RS03825 (729985) | 729985..731436 | - | 1452 | WP_059220135.1 | tagaturonate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14475.47 Da Isoelectric Point: 8.0833
>T271954 WP_059222236.1 NZ_CP117668:c727480-727094 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|