Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 53303..53904 Replicon plasmid pEA13_2
Accession NZ_CP117661
Organism Escherichia albertii strain BIA_13

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PS034_RS24555 Protein ID WP_001216034.1
Coordinates 53303..53683 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A765X875
Locus tag PS034_RS24560 Protein ID WP_032271830.1
Coordinates 53683..53904 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS034_RS24530 (PS034_24530) 48894..50087 - 1194 WP_273784098.1 terminase -
PS034_RS24535 (PS034_24535) 50295..51470 + 1176 WP_000942666.1 RNA-guided endonuclease TnpB family protein -
PS034_RS24540 (PS034_24540) 51507..51959 - 453 WP_032165150.1 Late promoter-activating protein -
PS034_RS24545 (PS034_24545) 52048..53091 - 1044 WP_273784097.1 DUF968 domain-containing protein -
PS034_RS24550 (PS034_24550) 53119..53298 - 180 WP_024262170.1 hypothetical protein -
PS034_RS24555 (PS034_24555) 53303..53683 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PS034_RS24560 (PS034_24560) 53683..53904 - 222 WP_032271830.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PS034_RS24565 (PS034_24565) 53977..54366 - 390 WP_000506730.1 S24 family peptidase -
PS034_RS24570 (PS034_24570) 54541..55113 + 573 WP_001133670.1 hypothetical protein -
PS034_RS24575 (PS034_24575) 55120..55371 - 252 WP_001667237.1 DNA polymerase III subunit theta -
PS034_RS24580 (PS034_24580) 56034..56396 - 363 WP_062905072.1 hypothetical protein -
PS034_RS24585 (PS034_24585) 56393..56728 - 336 WP_273823185.1 hypothetical protein -
PS034_RS24590 (PS034_24590) 56733..57329 - 597 WP_273818034.1 hypothetical protein -
PS034_RS24595 (PS034_24595) 57311..57685 - 375 WP_001749397.1 hypothetical protein -
PS034_RS24600 (PS034_24600) 57692..57985 - 294 WP_000269004.1 hypothetical protein -
PS034_RS24605 (PS034_24605) 58164..58397 - 234 WP_000517420.1 hypothetical protein -
PS034_RS24610 (PS034_24610) 58474..58734 - 261 WP_001554875.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..101097 101097
- flank IS/Tn - - 50295..51470 1175


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T271941 WP_001216034.1 NZ_CP117661:c53683-53303 [Escherichia albertii]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8161.16 Da        Isoelectric Point: 5.1106

>AT271941 WP_032271830.1 NZ_CP117661:c53904-53683 [Escherichia albertii]
MRSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A765X875

References