Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4612878..4613494 | Replicon | chromosome |
| Accession | NZ_CP117659 | ||
| Organism | Escherichia albertii strain BIA_13 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PS034_RS22450 | Protein ID | WP_107192776.1 |
| Coordinates | 4612878..4613252 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PS034_RS22455 | Protein ID | WP_103054107.1 |
| Coordinates | 4613252..4613494 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS034_RS22435 (4610381) | 4610381..4611283 | + | 903 | WP_000331386.1 | formate dehydrogenase O subunit beta | - |
| PS034_RS22440 (4611280) | 4611280..4611915 | + | 636 | WP_000829019.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PS034_RS22445 (4611912) | 4611912..4612841 | + | 930 | WP_000027704.1 | formate dehydrogenase accessory protein FdhE | - |
| PS034_RS22450 (4612878) | 4612878..4613252 | - | 375 | WP_107192776.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PS034_RS22455 (4613252) | 4613252..4613494 | - | 243 | WP_103054107.1 | CopG family transcriptional regulator | Antitoxin |
| PS034_RS22460 (4613722) | 4613722..4613940 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| PS034_RS22465 (4614339) | 4614339..4614617 | - | 279 | WP_032278934.1 | hypothetical protein | - |
| PS034_RS22470 (4614679) | 4614679..4614891 | - | 213 | WP_000197774.1 | hypothetical protein | - |
| PS034_RS22475 (4614976) | 4614976..4615266 | - | 291 | WP_000356397.1 | NadS family protein | - |
| PS034_RS22480 (4615267) | 4615267..4615578 | - | 312 | WP_000897302.1 | hypothetical protein | - |
| PS034_RS22485 (4615807) | 4615807..4616715 | + | 909 | WP_273822320.1 | alpha/beta hydrolase | - |
| PS034_RS22490 (4616779) | 4616779..4617720 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PS034_RS22495 (4617765) | 4617765..4618202 | - | 438 | WP_000560979.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13944.15 Da Isoelectric Point: 8.4539
>T271938 WP_107192776.1 NZ_CP117659:c4613252-4612878 [Escherichia albertii]
MAKRTALFDTNILIDLFSGRIESKQALEAWPLQNAISLVTWMEVLVGAKKYNQEHRTQIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP
MAKRTALFDTNILIDLFSGRIESKQALEAWPLQNAISLVTWMEVLVGAKKYNQEHRTQIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|