Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3512375..3512993 | Replicon | chromosome |
| Accession | NZ_CP117659 | ||
| Organism | Escherichia albertii strain BIA_13 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS034_RS17275 | Protein ID | WP_001280991.1 |
| Coordinates | 3512775..3512993 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS034_RS17270 | Protein ID | WP_000344798.1 |
| Coordinates | 3512375..3512749 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS034_RS17260 (3507455) | 3507455..3508648 | + | 1194 | WP_273822103.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS034_RS17265 (3508671) | 3508671..3511820 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS034_RS17270 (3512375) | 3512375..3512749 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS034_RS17275 (3512775) | 3512775..3512993 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS034_RS17280 (3513170) | 3513170..3513727 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| PS034_RS17285 (3513834) | 3513834..3514304 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| PS034_RS17290 (3514468) | 3514468..3516018 | + | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| PS034_RS17295 (3516056) | 3516056..3516409 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS034_RS17305 (3516790) | 3516790..3517101 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| PS034_RS17310 (3517131) | 3517131..3517703 | - | 573 | WP_059234328.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271931 WP_001280991.1 NZ_CP117659:3512775-3512993 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271931 WP_000344798.1 NZ_CP117659:3512375-3512749 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|