Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 53507..54108 | Replicon | plasmid pEA15_2 |
Accession | NZ_CP117656 | ||
Organism | Escherichia albertii strain BIA_15 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | PS036_RS24760 | Protein ID | WP_001216034.1 |
Coordinates | 53507..53887 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | PS036_RS24765 | Protein ID | WP_001190712.1 |
Coordinates | 53887..54108 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS036_RS24735 (PS036_24735) | 49183..50376 | - | 1194 | WP_273811299.1 | terminase | - |
PS036_RS24740 (PS036_24740) | 50442..51653 | - | 1212 | WP_124866782.1 | RNA-guided endonuclease TnpB family protein | - |
PS036_RS24745 (PS036_24745) | 51696..52163 | - | 468 | WP_059257205.1 | hypothetical protein | - |
PS036_RS24750 (PS036_24750) | 52252..53295 | - | 1044 | WP_059257204.1 | DUF968 domain-containing protein | - |
PS036_RS24755 (PS036_24755) | 53323..53502 | - | 180 | WP_000113018.1 | hypothetical protein | - |
PS036_RS24760 (PS036_24760) | 53507..53887 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PS036_RS24765 (PS036_24765) | 53887..54108 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PS036_RS24770 (PS036_24770) | 54291..55847 | + | 1557 | WP_059257212.1 | type I restriction-modification system subunit M | - |
PS036_RS24775 (PS036_24775) | 55844..57079 | + | 1236 | WP_059257202.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..98591 | 98591 | |
- | flank | IS/Tn | - | - | 50442..51593 | 1151 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T271916 WP_001216034.1 NZ_CP117656:c53887-53507 [Escherichia albertii]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |