Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 78779..79404 | Replicon | plasmid pEA15_1 |
| Accession | NZ_CP117655 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PS036_RS24120 | Protein ID | WP_000911317.1 |
| Coordinates | 79006..79404 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PS036_RS24115 | Protein ID | WP_059277990.1 |
| Coordinates | 78779..79006 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS24115 (78779) | 78779..79006 | + | 228 | WP_059277990.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PS036_RS24120 (79006) | 79006..79404 | + | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PS036_RS24125 (79413) | 79413..80660 | - | 1248 | Protein_81 | type IV secretion system DNA-binding domain-containing protein | - |
| PS036_RS24130 (80690) | 80690..82261 | - | 1572 | WP_273810715.1 | IS66 family transposase | - |
| PS036_RS24135 (82281) | 82281..82628 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS036_RS24140 (82628) | 82628..83305 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| PS036_RS24145 (83359) | 83359..84273 | - | 915 | Protein_85 | type IV secretion system DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 / espL2 / vat | 1..130064 | 130064 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T271912 WP_000911317.1 NZ_CP117655:79006-79404 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|