Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 66975..67750 Replicon plasmid pEA15_1
Accession NZ_CP117655
Organism Escherichia albertii strain BIA_15

Toxin (Protein)


Gene name tacT Uniprot ID A0A8D9PPA8
Locus tag PS036_RS24055 Protein ID WP_000405244.1
Coordinates 66975..67457 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag PS036_RS24060 Protein ID WP_076741381.1
Coordinates 67448..67750 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS036_RS24025 (62763) 62763..63622 + 860 Protein_61 IS3 family transposase -
PS036_RS24030 (63721) 63721..64002 - 282 WP_000780222.1 helix-turn-helix transcriptional regulator -
PS036_RS24035 (63983) 63983..64312 - 330 WP_059236325.1 type II toxin-antitoxin system RelE/ParE family toxin -
PS036_RS24040 (65252) 65252..66109 - 858 WP_137648027.1 incFII family plasmid replication initiator RepA -
PS036_RS24045 (66102) 66102..66176 - 75 WP_001367777.1 RepA leader peptide Tap -
PS036_RS24050 (66408) 66408..66665 - 258 WP_000083845.1 replication regulatory protein RepA -
PS036_RS24055 (66975) 66975..67457 - 483 WP_000405244.1 GNAT family N-acetyltransferase Toxin
PS036_RS24060 (67448) 67448..67750 - 303 WP_076741381.1 DUF1778 domain-containing protein Antitoxin
PS036_RS24065 (67988) 67988..68137 - 150 WP_001336447.1 Hok/Gef family protein -
- (68181) 68181..68242 + 62 NuclAT_1 - -
- (68181) 68181..68242 + 62 NuclAT_1 - -
- (68181) 68181..68242 + 62 NuclAT_1 - -
- (68181) 68181..68242 + 62 NuclAT_1 - -
PS036_RS24070 (68417) 68417..68656 - 240 Protein_70 DUF2726 domain-containing protein -
PS036_RS24075 (68707) 68707..69384 + 678 WP_001339397.1 IS66-like element accessory protein TnpA -
PS036_RS24080 (69384) 69384..69731 + 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
PS036_RS24085 (69751) 69751..71322 + 1572 WP_273810715.1 IS66 family transposase -
PS036_RS24090 (71352) 71352..71504 - 153 Protein_74 hypothetical protein -
PS036_RS24095 (71698) 71698..71910 - 213 WP_059278122.1 hypothetical protein -
PS036_RS24100 (72046) 72046..72606 - 561 WP_258146168.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - espL2 / espL2 / vat 1..130064 130064


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(30-149)

Antitoxin

Vibrio phage ICP1, Orf50

(15-99)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17659.41 Da        Isoelectric Point: 7.1036

>T271907 WP_000405244.1 NZ_CP117655:c67457-66975 [Escherichia albertii]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLHGRAMKNQMLNASRTFVICLEGTLRVVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11601.21 Da        Isoelectric Point: 4.5609

>AT271907 WP_076741381.1 NZ_CP117655:c67750-67448 [Escherichia albertii]
MEVVMPTTASIRKTPRENQINIRATDEERAVIDYAASLVNKNRTDFIIELAYQEAKNIILDQRLFVLDNECYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References