Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 43484..44127 | Replicon | plasmid pEA15_1 |
| Accession | NZ_CP117655 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | PS036_RS23955 | Protein ID | WP_053884725.1 |
| Coordinates | 43711..44127 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A5Z7X8E3 |
| Locus tag | PS036_RS23950 | Protein ID | WP_001644959.1 |
| Coordinates | 43484..43714 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS23920 (38919) | 38919..39632 | - | 714 | WP_072244077.1 | putative DNA-binding domain-containing protein | - |
| PS036_RS23925 (39607) | 39607..40458 | - | 852 | WP_059278008.1 | DUF692 domain-containing protein | - |
| PS036_RS23930 (40446) | 40446..40763 | - | 318 | WP_059278007.1 | hypothetical protein | - |
| PS036_RS23935 (40767) | 40767..41717 | - | 951 | WP_059257123.1 | MBL fold metallo-hydrolase | - |
| PS036_RS23940 (42422) | 42422..42988 | - | 567 | WP_059278006.1 | MarC family protein | - |
| PS036_RS23945 (43072) | 43072..43197 | + | 126 | WP_273811202.1 | hypothetical protein | - |
| PS036_RS23950 (43484) | 43484..43714 | + | 231 | WP_001644959.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PS036_RS23955 (43711) | 43711..44127 | + | 417 | WP_053884725.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PS036_RS23960 (44283) | 44283..45092 | + | 810 | WP_059278005.1 | class I SAM-dependent methyltransferase | - |
| PS036_RS23965 (45258) | 45258..45398 | - | 141 | WP_273811229.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 / espL2 / vat | 1..130064 | 130064 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15079.42 Da Isoelectric Point: 7.8874
>T271906 WP_053884725.1 NZ_CP117655:43711-44127 [Escherichia albertii]
VNKTYMLDTNICSFIMREQPEAVIRRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHGQLVDAFCARLDAILPWDRA
AVDATVEVKAALTAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPNLVLEDWVK
VNKTYMLDTNICSFIMREQPEAVIRRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHGQLVDAFCARLDAILPWDRA
AVDATVEVKAALTAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPNLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|