Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
| Location | 4395447..4396491 | Replicon | chromosome |
| Accession | NZ_CP117654 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | panT | Uniprot ID | - |
| Locus tag | PS036_RS21975 | Protein ID | WP_089557599.1 |
| Coordinates | 4395447..4395995 (-) | Length | 183 a.a. |
Antitoxin (Protein)
| Gene name | panA | Uniprot ID | A0A799QL68 |
| Locus tag | PS036_RS21980 | Protein ID | WP_059242328.1 |
| Coordinates | 4396018..4396491 (-) | Length | 158 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS21905 (4390573) | 4390573..4390713 | + | 141 | WP_001198866.1 | protease FtsH-inhibitory lysogeny factor CIII | - |
| PS036_RS21910 (4390706) | 4390706..4390819 | + | 114 | WP_000361831.1 | host cell division inhibitory peptide Kil | - |
| PS036_RS21915 (4390816) | 4390816..4391004 | + | 189 | WP_000613343.1 | hypothetical protein | - |
| PS036_RS21920 (4391013) | 4391013..4391693 | + | 681 | WP_000536247.1 | ATP-binding protein | - |
| PS036_RS21925 (4391690) | 4391690..4392277 | + | 588 | WP_001535902.1 | hypothetical protein | - |
| PS036_RS21930 (4392301) | 4392301..4392597 | + | 297 | WP_059278101.1 | DUF2856 family protein | - |
| PS036_RS21935 (4392608) | 4392608..4392898 | + | 291 | WP_072249176.1 | DUF5405 family protein | - |
| PS036_RS21940 (4392895) | 4392895..4393059 | + | 165 | WP_001214452.1 | DUF2737 family protein | - |
| PS036_RS21945 (4393179) | 4393179..4393646 | + | 468 | Protein_4286 | hypothetical protein | - |
| PS036_RS21950 (4393648) | 4393648..4393839 | + | 192 | WP_273810798.1 | hypothetical protein | - |
| PS036_RS21955 (4393841) | 4393841..4393966 | + | 126 | Protein_4288 | DUF551 domain-containing protein | - |
| PS036_RS21960 (4393940) | 4393940..4394197 | + | 258 | Protein_4289 | valyl-tRNA synthetase | - |
| PS036_RS21965 (4394532) | 4394532..4395104 | + | 573 | WP_059242324.1 | 3'-5' exonuclease | - |
| PS036_RS21970 (4395141) | 4395141..4395413 | + | 273 | WP_001093911.1 | pyocin activator PrtN family protein | - |
| PS036_RS21975 (4395447) | 4395447..4395995 | - | 549 | WP_089557599.1 | hypothetical protein | Toxin |
| PS036_RS21980 (4396018) | 4396018..4396491 | - | 474 | WP_059242328.1 | DUF4065 domain-containing protein | Antitoxin |
| PS036_RS21985 (4397016) | 4397016..4397531 | + | 516 | WP_002460756.1 | zinc uptake transcriptional repressor Zur | - |
| PS036_RS21990 (4397572) | 4397572..4397781 | - | 210 | WP_059276314.1 | CsbD family protein | - |
| PS036_RS21995 (4397897) | 4397897..4399222 | - | 1326 | WP_059276315.1 | MATE family efflux transporter DinF | - |
| PS036_RS22000 (4399297) | 4399297..4399905 | - | 609 | WP_059220446.1 | transcriptional repressor LexA | - |
| PS036_RS22005 (4400015) | 4400015..4400383 | - | 369 | WP_000002912.1 | diacylglycerol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4345739..4399905 | 54166 | |
| - | inside | Prophage | - | - | 4345739..4400383 | 54644 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 183 a.a. Molecular weight: 20095.63 Da Isoelectric Point: 4.6708
>T271905 WP_089557599.1 NZ_CP117654:c4395995-4395447 [Escherichia albertii]
MSRNSDIYKLIGAAAGVENGRSEASLNYTDSQEQVFKSAFEPSNHESDDDSSSENKAILEEEEFGSNTGALHEFMQQHRM
NSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVCFMSWWCLFVAVMFVSFLIAHEGKPPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDGDKEK
MSRNSDIYKLIGAAAGVENGRSEASLNYTDSQEQVFKSAFEPSNHESDDDSSSENKAILEEEEFGSNTGALHEFMQQHRM
NSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVCFMSWWCLFVAVMFVSFLIAHEGKPPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDGDKEK
Download Length: 549 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17369.87 Da Isoelectric Point: 7.9143
>AT271905 WP_059242328.1 NZ_CP117654:c4396491-4396018 [Escherichia albertii]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQTYNGIGSSIIPDDAIKTYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQTYNGIGSSIIPDDAIKTYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|