Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3512696..3513314 | Replicon | chromosome |
| Accession | NZ_CP117654 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS036_RS17515 | Protein ID | WP_001280991.1 |
| Coordinates | 3513096..3513314 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS036_RS17510 | Protein ID | WP_000344798.1 |
| Coordinates | 3512696..3513070 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS17500 (3507776) | 3507776..3508969 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS036_RS17505 (3508992) | 3508992..3512141 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS036_RS17510 (3512696) | 3512696..3513070 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS036_RS17515 (3513096) | 3513096..3513314 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS036_RS17520 (3513491) | 3513491..3514048 | + | 558 | WP_059221620.1 | maltose O-acetyltransferase | - |
| PS036_RS17525 (3514156) | 3514156..3514626 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| PS036_RS17530 (3514790) | 3514790..3516340 | + | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| PS036_RS17535 (3516378) | 3516378..3516548 | - | 171 | Protein_3421 | DUF1428 family protein | - |
| PS036_RS17540 (3516605) | 3516605..3517282 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| PS036_RS17545 (3517282) | 3517282..3517629 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271902 WP_001280991.1 NZ_CP117654:3513096-3513314 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271902 WP_000344798.1 NZ_CP117654:3512696-3513070 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|