Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2789923..2790401 Replicon chromosome
Accession NZ_CP117654
Organism Escherichia albertii strain BIA_15

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag PS036_RS13985 Protein ID WP_069722732.1
Coordinates 2790114..2790401 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A7D7PD17
Locus tag PS036_RS13980 Protein ID WP_069722731.1
Coordinates 2789923..2790114 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS036_RS13950 (2785526) 2785526..2786860 + 1335 WP_273810740.1 FRG domain-containing protein -
PS036_RS13955 (2787099) 2787099..2787521 - 423 WP_273810741.1 DUF977 family protein -
PS036_RS13960 (2787562) 2787562..2788632 - 1071 WP_273810742.1 phage replisome organizer -
PS036_RS13965 (2788704) 2788704..2789129 - 426 WP_062863952.1 toxin YdaT family protein -
PS036_RS13970 (2789113) 2789113..2789385 - 273 WP_069722730.1 YdaS family helix-turn-helix protein -
PS036_RS13975 (2789494) 2789494..2789895 + 402 WP_062898147.1 helix-turn-helix domain-containing protein -
PS036_RS13980 (2789923) 2789923..2790114 + 192 WP_069722731.1 antitoxin Antitoxin
PS036_RS13985 (2790114) 2790114..2790401 + 288 WP_069722732.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS036_RS13990 (2790676) 2790676..2790831 + 156 WP_000379575.1 DUF1391 family protein -
PS036_RS13995 (2790833) 2790833..2790961 + 129 WP_000344961.1 protein YdfB -
PS036_RS14000 (2790991) 2790991..2791209 + 219 WP_001171920.1 protein YdfC -
PS036_RS14005 (2791778) 2791778..2791966 + 189 WP_059276496.1 cell division inhibition protein DicB -
PS036_RS14010 (2791963) 2791963..2792154 + 192 WP_001090200.1 DUF1482 family protein -
PS036_RS14015 (2792247) 2792247..2794718 + 2472 WP_273810743.1 exonuclease -
PS036_RS14020 (2794780) 2794780..2795049 + 270 WP_000003742.1 excisionase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - cif / nleH1 2752167..2803306 51139
- inside Prophage - cif / nleH1 2750920..2803306 52386


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10950.83 Da        Isoelectric Point: 10.1360

>T271901 WP_069722732.1 NZ_CP117654:2790114-2790401 [Escherichia albertii]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7053.82 Da        Isoelectric Point: 4.0270

>AT271901 WP_069722731.1 NZ_CP117654:2789923-2790114 [Escherichia albertii]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7D7PD17

References