Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 2789923..2790401 | Replicon | chromosome |
| Accession | NZ_CP117654 | ||
| Organism | Escherichia albertii strain BIA_15 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | - |
| Locus tag | PS036_RS13985 | Protein ID | WP_069722732.1 |
| Coordinates | 2790114..2790401 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | A0A7D7PD17 |
| Locus tag | PS036_RS13980 | Protein ID | WP_069722731.1 |
| Coordinates | 2789923..2790114 (+) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS036_RS13950 (2785526) | 2785526..2786860 | + | 1335 | WP_273810740.1 | FRG domain-containing protein | - |
| PS036_RS13955 (2787099) | 2787099..2787521 | - | 423 | WP_273810741.1 | DUF977 family protein | - |
| PS036_RS13960 (2787562) | 2787562..2788632 | - | 1071 | WP_273810742.1 | phage replisome organizer | - |
| PS036_RS13965 (2788704) | 2788704..2789129 | - | 426 | WP_062863952.1 | toxin YdaT family protein | - |
| PS036_RS13970 (2789113) | 2789113..2789385 | - | 273 | WP_069722730.1 | YdaS family helix-turn-helix protein | - |
| PS036_RS13975 (2789494) | 2789494..2789895 | + | 402 | WP_062898147.1 | helix-turn-helix domain-containing protein | - |
| PS036_RS13980 (2789923) | 2789923..2790114 | + | 192 | WP_069722731.1 | antitoxin | Antitoxin |
| PS036_RS13985 (2790114) | 2790114..2790401 | + | 288 | WP_069722732.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS036_RS13990 (2790676) | 2790676..2790831 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| PS036_RS13995 (2790833) | 2790833..2790961 | + | 129 | WP_000344961.1 | protein YdfB | - |
| PS036_RS14000 (2790991) | 2790991..2791209 | + | 219 | WP_001171920.1 | protein YdfC | - |
| PS036_RS14005 (2791778) | 2791778..2791966 | + | 189 | WP_059276496.1 | cell division inhibition protein DicB | - |
| PS036_RS14010 (2791963) | 2791963..2792154 | + | 192 | WP_001090200.1 | DUF1482 family protein | - |
| PS036_RS14015 (2792247) | 2792247..2794718 | + | 2472 | WP_273810743.1 | exonuclease | - |
| PS036_RS14020 (2794780) | 2794780..2795049 | + | 270 | WP_000003742.1 | excisionase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | cif / nleH1 | 2752167..2803306 | 51139 | |
| - | inside | Prophage | - | cif / nleH1 | 2750920..2803306 | 52386 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10950.83 Da Isoelectric Point: 10.1360
>T271901 WP_069722732.1 NZ_CP117654:2790114-2790401 [Escherichia albertii]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|