Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 893058..893709 | Replicon | chromosome |
Accession | NZ_CP117654 | ||
Organism | Escherichia albertii strain BIA_15 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B1EG01 |
Locus tag | PS036_RS04320 | Protein ID | WP_000244763.1 |
Coordinates | 893305..893709 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS036_RS04315 | Protein ID | WP_000354046.1 |
Coordinates | 893058..893324 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS036_RS04285 (888068) | 888068..888961 | + | 894 | WP_059221140.1 | transporter | - |
PS036_RS04290 (889008) | 889008..890441 | - | 1434 | WP_024164724.1 | 6-phospho-beta-glucosidase BglA | - |
PS036_RS04295 (890486) | 890486..890797 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PS036_RS04300 (890965) | 890965..891624 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
PS036_RS04305 (891826) | 891826..892806 | - | 981 | WP_059221136.1 | tRNA-modifying protein YgfZ | - |
PS036_RS04310 (892838) | 892838..893068 | + | 231 | WP_000181267.1 | hypothetical protein | - |
PS036_RS04315 (893058) | 893058..893324 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS036_RS04320 (893305) | 893305..893709 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
PS036_RS04325 (893748) | 893748..894269 | - | 522 | WP_273810835.1 | flavodoxin FldB | - |
PS036_RS04330 (894381) | 894381..895277 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PS036_RS04335 (895302) | 895302..896012 | + | 711 | WP_059275564.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS036_RS04340 (896018) | 896018..897751 | + | 1734 | WP_059221131.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271890 WP_000244763.1 NZ_CP117654:893305-893709 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6P9B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |