Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 293656..294456 | Replicon | chromosome |
Accession | NZ_CP117654 | ||
Organism | Escherichia albertii strain BIA_15 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | PS036_RS01365 | Protein ID | WP_273810814.1 |
Coordinates | 293929..294456 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | PS036_RS01360 | Protein ID | WP_001277106.1 |
Coordinates | 293656..293922 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS036_RS01340 (289312) | 289312..289980 | + | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
PS036_RS01345 (289973) | 289973..291031 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
PS036_RS01350 (291276) | 291276..292130 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
PS036_RS01355 (292403) | 292403..293506 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
PS036_RS01360 (293656) | 293656..293922 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
PS036_RS01365 (293929) | 293929..294456 | + | 528 | WP_273810814.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
PS036_RS01370 (294453) | 294453..294836 | - | 384 | WP_059220922.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
PS036_RS01375 (295260) | 295260..296369 | + | 1110 | WP_059220920.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PS036_RS01380 (296417) | 296417..297343 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PS036_RS01385 (297340) | 297340..298617 | + | 1278 | WP_059275495.1 | branched chain amino acid ABC transporter permease LivM | - |
PS036_RS01390 (298614) | 298614..299381 | + | 768 | WP_000083515.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19502.43 Da Isoelectric Point: 6.6303
>T271889 WP_273810814.1 NZ_CP117654:293929-294456 [Escherichia albertii]
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVILGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVILGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|