Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 23375..24132 | Replicon | plasmid pEA16-1_2 |
| Accession | NZ_CP117652 | ||
| Organism | Escherichia albertii strain BIA_16-1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | PS055_RS22880 | Protein ID | WP_059222167.1 |
| Coordinates | 23375..23860 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | PS055_RS22885 | Protein ID | WP_001352814.1 |
| Coordinates | 23848..24132 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS055_RS22850 (19013) | 19013..19456 | - | 444 | WP_059222164.1 | lytic transglycosylase domain-containing protein | - |
| PS055_RS22855 (19464) | 19464..20357 | - | 894 | WP_059222165.1 | transcriptional regulator HilD | - |
| PS055_RS22860 (20618) | 20618..20941 | - | 324 | WP_273819658.1 | adhesin biosynthesis transcription regulatory family protein | - |
| PS055_RS22865 (21502) | 21502..21867 | + | 366 | WP_273819659.1 | hypothetical protein | - |
| PS055_RS22870 (21867) | 21867..22883 | + | 1017 | Protein_23 | transposase zinc-binding domain-containing protein | - |
| PS055_RS22875 (23065) | 23065..23391 | + | 327 | Protein_24 | SDR family oxidoreductase | - |
| PS055_RS22880 (23375) | 23375..23860 | - | 486 | WP_059222167.1 | GNAT family N-acetyltransferase | Toxin |
| PS055_RS22885 (23848) | 23848..24132 | - | 285 | WP_001352814.1 | DUF1778 domain-containing protein | Antitoxin |
| PS055_RS22890 (25048) | 25048..25905 | - | 858 | WP_059222168.1 | incFII family plasmid replication initiator RepA | - |
| PS055_RS22895 (25898) | 25898..25972 | - | 75 | WP_059222184.1 | RepA leader peptide Tap | - |
| PS055_RS22900 (26021) | 26021..26620 | - | 600 | Protein_29 | DUF2726 domain-containing protein | - |
| PS055_RS22905 (26659) | 26659..26868 | - | 210 | WP_059222169.1 | hemolysin expression modulator Hha | - |
| PS055_RS22910 (26914) | 26914..27375 | - | 462 | WP_059222170.1 | thermonuclease family protein | - |
| PS055_RS22915 (27621) | 27621..27833 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PS055_RS22920 (27969) | 27969..28529 | - | 561 | WP_001587438.1 | fertility inhibition protein FinO | - |
| PS055_RS22925 (28583) | 28583..29005 | - | 423 | Protein_34 | type-F conjugative transfer system pilin acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | cofA | 1..52153 | 52153 | |
| - | flank | IS/Tn | - | - | 21867..22100 | 233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17756.56 Da Isoelectric Point: 9.9107
>T271886 WP_059222167.1 NZ_CP117652:c23860-23375 [Escherichia albertii]
MGCVTAPEPLSSFHQAAEFVSGEVVLDDWLKQKGLKNQALGATRTFVVCRKGTQQIVVFYSLATGSVNHTEATGNLRRNM
SDPIPVIILARLAVDMSFRGKGFGADLLHDAVRRCYRVAENIGVRAIMVHALTESAKQFYIHHGFTPSKTQVQTLFLKLP
Q
MGCVTAPEPLSSFHQAAEFVSGEVVLDDWLKQKGLKNQALGATRTFVVCRKGTQQIVVFYSLATGSVNHTEATGNLRRNM
SDPIPVIILARLAVDMSFRGKGFGADLLHDAVRRCYRVAENIGVRAIMVHALTESAKQFYIHHGFTPSKTQVQTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|