Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 4791..5392 | Replicon | plasmid pEA16-1_1 |
Accession | NZ_CP117651 | ||
Organism | Escherichia albertii strain BIA_16-1 |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9YA20 |
Locus tag | PS055_RS22265 | Protein ID | WP_001216045.1 |
Coordinates | 5012..5392 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | PS055_RS22260 | Protein ID | WP_059222009.1 |
Coordinates | 4791..5012 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS055_RS22250 (PS055_22250) | 1835..3055 | - | 1221 | WP_148880112.1 | restriction endonuclease subunit S | - |
PS055_RS22255 (PS055_22255) | 3052..4608 | - | 1557 | WP_059222023.1 | type I restriction-modification system subunit M | - |
PS055_RS22260 (PS055_22260) | 4791..5012 | + | 222 | WP_059222009.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PS055_RS22265 (PS055_22265) | 5012..5392 | + | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PS055_RS22270 (PS055_22270) | 5397..5576 | + | 180 | WP_059222008.1 | hypothetical protein | - |
PS055_RS22275 (PS055_22275) | 5604..6647 | + | 1044 | WP_059222007.1 | DUF968 domain-containing protein | - |
PS055_RS22280 (PS055_22280) | 6736..7188 | + | 453 | WP_032165150.1 | Late promoter-activating protein | - |
PS055_RS22285 (PS055_22285) | 7225..8400 | - | 1176 | WP_000942666.1 | RNA-guided endonuclease TnpB family protein | - |
PS055_RS22290 (PS055_22290) | 8608..9801 | + | 1194 | WP_059222006.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..99447 | 99447 | |
- | flank | IS/Tn | - | - | 7225..8400 | 1175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T271885 WP_001216045.1 NZ_CP117651:5012-5392 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|