Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4152620..4153238 | Replicon | chromosome |
| Accession | NZ_CP117650 | ||
| Organism | Escherichia albertii strain BIA_16-1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS055_RS20175 | Protein ID | WP_001280991.1 |
| Coordinates | 4152620..4152838 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS055_RS20180 | Protein ID | WP_000344798.1 |
| Coordinates | 4152864..4153238 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS055_RS20140 (4147909) | 4147909..4148481 | + | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
| PS055_RS20145 (4148511) | 4148511..4148822 | - | 312 | WP_000409915.1 | MGMT family protein | - |
| PS055_RS20155 (4149203) | 4149203..4149556 | + | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS055_RS20160 (4149594) | 4149594..4151144 | - | 1551 | WP_059221618.1 | EAL domain-containing protein | - |
| PS055_RS20165 (4151308) | 4151308..4151778 | - | 471 | WP_000136188.1 | YlaC family protein | - |
| PS055_RS20170 (4151886) | 4151886..4152443 | - | 558 | WP_059221620.1 | maltose O-acetyltransferase | - |
| PS055_RS20175 (4152620) | 4152620..4152838 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS055_RS20180 (4152864) | 4152864..4153238 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS055_RS20185 (4153793) | 4153793..4156942 | - | 3150 | WP_059221622.1 | efflux RND transporter permease AcrB | - |
| PS055_RS20190 (4156965) | 4156965..4158158 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271884 WP_001280991.1 NZ_CP117650:c4152838-4152620 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271884 WP_000344798.1 NZ_CP117650:c4153238-4152864 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|