Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2663668..2664468 | Replicon | chromosome |
| Accession | NZ_CP117650 | ||
| Organism | Escherichia albertii strain BIA_16-1 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | PS055_RS13100 | Protein ID | WP_059220924.1 |
| Coordinates | 2663668..2664195 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | PS055_RS13105 | Protein ID | WP_001277106.1 |
| Coordinates | 2664202..2664468 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS055_RS13075 (2658743) | 2658743..2659510 | - | 768 | WP_000083515.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PS055_RS13080 (2659507) | 2659507..2660784 | - | 1278 | WP_059220918.1 | branched chain amino acid ABC transporter permease LivM | - |
| PS055_RS13085 (2660781) | 2660781..2661707 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PS055_RS13090 (2661755) | 2661755..2662864 | - | 1110 | WP_059220920.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PS055_RS13095 (2663288) | 2663288..2663671 | + | 384 | WP_059220922.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| PS055_RS13100 (2663668) | 2663668..2664195 | - | 528 | WP_059220924.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| PS055_RS13105 (2664202) | 2664202..2664468 | - | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| PS055_RS13110 (2664618) | 2664618..2665721 | - | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| PS055_RS13115 (2665994) | 2665994..2666848 | - | 855 | WP_059220926.1 | RNA polymerase sigma factor RpoH | - |
| PS055_RS13120 (2667093) | 2667093..2668151 | - | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| PS055_RS13125 (2668144) | 2668144..2668812 | - | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19490.38 Da Isoelectric Point: 6.6303
>T271879 WP_059220924.1 NZ_CP117650:c2664195-2663668 [Escherichia albertii]
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRLDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVCSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|