Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 669759..670363 | Replicon | chromosome |
| Accession | NZ_CP117650 | ||
| Organism | Escherichia albertii strain BIA_16-1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A8H9B4D1 |
| Locus tag | PS055_RS03230 | Protein ID | WP_059222236.1 |
| Coordinates | 669759..670145 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS055_RS03235 | Protein ID | WP_001195490.1 |
| Coordinates | 670142..670363 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS055_RS03230 (669759) | 669759..670145 | - | 387 | WP_059222236.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS055_RS03235 (670142) | 670142..670363 | - | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS055_RS03240 (670781) | 670781..671329 | + | 549 | Protein_640 | trans-aconitate 2-methyltransferase | - |
| PS055_RS03245 (671329) | 671329..671583 | - | 255 | Protein_641 | bestrophin family ion channel | - |
| PS055_RS03250 (671788) | 671788..673239 | - | 1452 | WP_059220135.1 | tagaturonate reductase | - |
| PS055_RS03255 (673486) | 673486..674904 | - | 1419 | WP_000558269.1 | diguanylate cyclase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14475.47 Da Isoelectric Point: 8.0833
>T271872 WP_059222236.1 NZ_CP117650:c670145-669759 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|