Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/ElaA-DUF1778
Location 54786..55561 Replicon plasmid pEA16-3_1
Accession NZ_CP117648
Organism Escherichia albertii strain BIA_16-3

Toxin (Protein)


Gene name tacT Uniprot ID -
Locus tag PS048_RS23895 Protein ID WP_059257273.1
Coordinates 55079..55561 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag PS048_RS23890 Protein ID WP_072146426.1
Coordinates 54786..55088 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS048_RS23860 (50061) 50061..50273 + 213 WP_059257078.1 ANR family transcriptional regulator -
PS048_RS23865 (50519) 50519..50870 + 352 Protein_56 thermonuclease family protein -
PS048_RS23870 (50905) 50905..51114 + 210 WP_059257077.1 hemolysin expression modulator Hha -
PS048_RS23875 (51319) 51319..51756 + 438 WP_059257076.1 hypothetical protein -
- (51851) 51851..51912 - 62 NuclAT_0 - -
- (51851) 51851..51912 - 62 NuclAT_0 - -
- (51851) 51851..51912 - 62 NuclAT_0 - -
- (51851) 51851..51912 - 62 NuclAT_0 - -
PS048_RS23880 (51956) 51956..52126 + 171 WP_072247442.1 Hok/Gef family protein -
PS048_RS23885 (52693) 52693..54372 + 1680 WP_077871554.1 group II intron reverse transcriptase/maturase -
PS048_RS23890 (54786) 54786..55088 + 303 WP_072146426.1 DUF1778 domain-containing protein Antitoxin
PS048_RS23895 (55079) 55079..55561 + 483 WP_059257273.1 GNAT family N-acetyltransferase Toxin
PS048_RS23900 (55872) 55872..56126 + 255 WP_273786639.1 replication regulatory protein RepA -
PS048_RS23905 (56362) 56362..56436 + 75 WP_001375168.1 RepA leader peptide Tap -
PS048_RS23910 (56429) 56429..57286 + 858 WP_265463468.1 incFII family plasmid replication initiator RepA -
PS048_RS23915 (58200) 58200..58469 + 270 WP_059272212.1 type II toxin-antitoxin system antitoxin YacA -
PS048_RS23920 (58469) 58469..58747 + 279 WP_262939943.1 type II toxin-antitoxin system toxin YacB -
PS048_RS23925 (58793) 58793..59346 + 554 Protein_68 3'-5' exonuclease -
PS048_RS23930 (59632) 59632..59997 - 366 WP_262933613.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..82983 82983


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(41-146)

Antitoxin

Vibrio phage ICP1, Orf50

(15-99)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17650.45 Da        Isoelectric Point: 7.4024

>T271869 WP_059257273.1 NZ_CP117648:55079-55561 [Escherichia albertii]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNASRTFVICLEGTLRVVGFYSLATGSVTHAELGRSLRHN
MPSPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVANLAEQVGIKAVMVHAIDDDARAFYERFGFVRSVVAPDTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11648.21 Da        Isoelectric Point: 4.7174

>AT271869 WP_072146426.1 NZ_CP117648:54786-55088 [Escherichia albertii]
MEVFMSTAASVRKTPRENQINIRATDEERAVIDYAASLVNKNRTDFIIELAYQEAKNIILDQRLFVLDNERYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References