Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 42573..43198 | Replicon | plasmid pEA16-3_1 |
| Accession | NZ_CP117648 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A828AN07 |
| Locus tag | PS048_RS23835 | Protein ID | WP_059257082.1 |
| Coordinates | 42573..42971 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8H9EG71 |
| Locus tag | PS048_RS23840 | Protein ID | WP_000450526.1 |
| Coordinates | 42971..43198 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS23820 (38827) | 38827..39135 | - | 309 | WP_059257085.1 | heavy metal-binding domain-containing protein | - |
| PS048_RS23825 (39349) | 39349..40041 | + | 693 | WP_273786688.1 | hypothetical protein | - |
| PS048_RS23830 (40357) | 40357..42564 | + | 2208 | WP_273786690.1 | type IV conjugative transfer system coupling protein TraD | - |
| PS048_RS23835 (42573) | 42573..42971 | - | 399 | WP_059257082.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PS048_RS23840 (42971) | 42971..43198 | - | 228 | WP_000450526.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..82983 | 82983 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14945.27 Da Isoelectric Point: 7.8605
>T271864 WP_059257082.1 NZ_CP117648:c42971-42573 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNIREFERMDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNIREFERMDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|