Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4043741..4044317 | Replicon | chromosome |
Accession | NZ_CP117647 | ||
Organism | Escherichia albertii strain BIA_16-3 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A0K4FW98 |
Locus tag | PS048_RS19825 | Protein ID | WP_044708725.1 |
Coordinates | 4044030..4044317 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A0K4FU62 |
Locus tag | PS048_RS19820 | Protein ID | WP_054409941.1 |
Coordinates | 4043741..4044043 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS048_RS19795 (4039362) | 4039362..4039493 | - | 132 | WP_024164650.1 | hypothetical protein | - |
PS048_RS19800 (4039511) | 4039511..4039815 | - | 305 | Protein_3866 | Tar ligand binding domain-containing protein | - |
PS048_RS19805 (4040337) | 4040337..4042487 | + | 2151 | WP_273785046.1 | pyruvate/proton symporter BtsT | - |
PS048_RS19810 (4042537) | 4042537..4042740 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
PS048_RS19815 (4042751) | 4042751..4043707 | + | 957 | WP_002430330.1 | GTPase | - |
PS048_RS19820 (4043741) | 4043741..4044043 | - | 303 | WP_054409941.1 | BrnA antitoxin family protein | Antitoxin |
PS048_RS19825 (4044030) | 4044030..4044317 | - | 288 | WP_044708725.1 | BrnT family toxin | Toxin |
PS048_RS19830 (4044514) | 4044514..4045680 | + | 1167 | WP_000800832.1 | restriction endonuclease | - |
PS048_RS19835 (4045744) | 4045744..4047363 | + | 1620 | Protein_3873 | class I SAM-dependent DNA methyltransferase | - |
PS048_RS19840 (4047353) | 4047353..4048711 | + | 1359 | WP_273785054.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11155.59 Da Isoelectric Point: 6.9903
>T271859 WP_044708725.1 NZ_CP117647:c4044317-4044030 [Escherichia albertii]
MPMEFEWDANKAKSNQVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNQVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K4FW98 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K4FU62 |