Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3498684..3499302 | Replicon | chromosome |
| Accession | NZ_CP117647 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS048_RS17235 | Protein ID | WP_001280991.1 |
| Coordinates | 3499084..3499302 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS048_RS17230 | Protein ID | WP_000344798.1 |
| Coordinates | 3498684..3499058 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS17220 (3493764) | 3493764..3494957 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS048_RS17225 (3494980) | 3494980..3498129 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS048_RS17230 (3498684) | 3498684..3499058 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS048_RS17235 (3499084) | 3499084..3499302 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS048_RS17240 (3499479) | 3499479..3500036 | + | 558 | WP_137648729.1 | maltose O-acetyltransferase | - |
| PS048_RS17245 (3500144) | 3500144..3500614 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| PS048_RS17250 (3500778) | 3500778..3502328 | + | 1551 | WP_137648730.1 | EAL domain-containing protein | - |
| PS048_RS17255 (3502366) | 3502366..3502719 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS048_RS17265 (3503100) | 3503100..3503411 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| PS048_RS17270 (3503441) | 3503441..3504013 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271856 WP_001280991.1 NZ_CP117647:3499084-3499302 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271856 WP_000344798.1 NZ_CP117647:3498684-3499058 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|