Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2393528..2394132 | Replicon | chromosome |
| Accession | NZ_CP117647 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | B1EM00 |
| Locus tag | PS048_RS11765 | Protein ID | WP_000638401.1 |
| Coordinates | 2393746..2394132 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS048_RS11760 | Protein ID | WP_001195490.1 |
| Coordinates | 2393528..2393749 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS11745 (2389778) | 2389778..2391229 | + | 1452 | WP_273786478.1 | tagaturonate reductase | - |
| PS048_RS11750 (2391434) | 2391434..2392348 | + | 915 | WP_273786480.1 | bestrophin family protein | - |
| PS048_RS11755 (2392352) | 2392352..2393110 | - | 759 | WP_059218793.1 | trans-aconitate 2-methyltransferase | - |
| PS048_RS11760 (2393528) | 2393528..2393749 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS048_RS11765 (2393746) | 2393746..2394132 | + | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PS048_RS11770 (2394212) | 2394212..2395633 | - | 1422 | WP_273786481.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T271854 WP_000638401.1 NZ_CP117647:2393746-2394132 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T5VDW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6PD20 |