Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 936511..937162 | Replicon | chromosome |
Accession | NZ_CP117647 | ||
Organism | Escherichia albertii strain BIA_16-3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B1EG01 |
Locus tag | PS048_RS04535 | Protein ID | WP_000244763.1 |
Coordinates | 936758..937162 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS048_RS04530 | Protein ID | WP_000354046.1 |
Coordinates | 936511..936777 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS048_RS04505 (932223) | 932223..933656 | - | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
PS048_RS04510 (933701) | 933701..934012 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PS048_RS04515 (934180) | 934180..934839 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
PS048_RS04520 (935279) | 935279..936259 | - | 981 | WP_103053871.1 | tRNA-modifying protein YgfZ | - |
PS048_RS04525 (936291) | 936291..936521 | + | 231 | WP_000181267.1 | hypothetical protein | - |
PS048_RS04530 (936511) | 936511..936777 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS048_RS04535 (936758) | 936758..937162 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
PS048_RS04540 (937201) | 937201..937722 | - | 522 | WP_059235395.1 | flavodoxin FldB | - |
PS048_RS04545 (937834) | 937834..938730 | + | 897 | WP_059228147.1 | site-specific tyrosine recombinase XerD | - |
PS048_RS04550 (938755) | 938755..939465 | + | 711 | WP_273785785.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS048_RS04555 (939471) | 939471..941204 | + | 1734 | WP_273785787.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271847 WP_000244763.1 NZ_CP117647:936758-937162 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6P9B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |