Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 702177..703012 | Replicon | chromosome |
Accession | NZ_CP117647 | ||
Organism | Escherichia albertii strain BIA_16-3 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | PS048_RS03450 | Protein ID | WP_001685371.1 |
Coordinates | 702635..703012 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | PS048_RS03445 | Protein ID | WP_003986733.1 |
Coordinates | 702177..702545 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS048_RS03420 (699596) | 699596..699829 | + | 234 | WP_064986988.1 | DUF905 family protein | - |
PS048_RS03425 (699920) | 699920..700738 | + | 819 | WP_097331407.1 | DUF932 domain-containing protein | - |
PS048_RS03430 (700830) | 700830..701315 | + | 486 | WP_256917577.1 | antirestriction protein | - |
PS048_RS03435 (701331) | 701331..701807 | + | 477 | WP_001366855.1 | RadC family protein | - |
PS048_RS03440 (701876) | 701876..702097 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
PS048_RS03445 (702177) | 702177..702545 | + | 369 | WP_003986733.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PS048_RS03450 (702635) | 702635..703012 | + | 378 | WP_001685371.1 | TA system toxin CbtA family protein | Toxin |
PS048_RS03455 (703009) | 703009..703497 | + | 489 | WP_001685372.1 | DUF5983 family protein | - |
PS048_RS03460 (703509) | 703509..703685 | + | 177 | WP_001684188.1 | DUF957 domain-containing protein | - |
PS048_RS03465 (703791) | 703791..704636 | + | 846 | WP_256917573.1 | DUF4942 domain-containing protein | - |
PS048_RS03475 (704937) | 704937..705443 | + | 507 | WP_000245810.1 | G/U mismatch-specific DNA glycosylase | - |
PS048_RS03480 (705523) | 705523..707364 | - | 1842 | WP_000437385.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14321.41 Da Isoelectric Point: 9.2433
>T271846 WP_001685371.1 NZ_CP117647:702635-703012 [Escherichia albertii]
MKTLPDTLVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPRF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKR
MKTLPDTLVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPRF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13600.35 Da Isoelectric Point: 6.3159
>AT271846 WP_003986733.1 NZ_CP117647:702177-702545 [Escherichia albertii]
VSDTLPGTTHPDDNNDRPWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|