Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 314270..315070 | Replicon | chromosome |
| Accession | NZ_CP117647 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | PS048_RS01495 | Protein ID | WP_273785535.1 |
| Coordinates | 314543..315070 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A8H9C3F4 |
| Locus tag | PS048_RS01490 | Protein ID | WP_001277105.1 |
| Coordinates | 314270..314536 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS01465 (309991) | 309991..310845 | - | 855 | WP_000370584.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| PS048_RS01470 (310838) | 310838..311584 | - | 747 | WP_000151888.1 | PTS sugar transporter subunit IIC | - |
| PS048_RS01475 (311601) | 311601..312086 | - | 486 | WP_000029259.1 | PTS sugar transporter subunit IIB | - |
| PS048_RS01480 (312093) | 312093..312494 | - | 402 | WP_273785531.1 | PTS sugar transporter subunit IIA | - |
| PS048_RS01485 (313017) | 313017..314120 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| PS048_RS01490 (314270) | 314270..314536 | + | 267 | WP_001277105.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| PS048_RS01495 (314543) | 314543..315070 | + | 528 | WP_273785535.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| PS048_RS01500 (315067) | 315067..315450 | - | 384 | WP_000778774.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| PS048_RS01505 (315874) | 315874..316983 | + | 1110 | WP_000827693.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PS048_RS01510 (317031) | 317031..317957 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PS048_RS01515 (317954) | 317954..319231 | + | 1278 | WP_059225128.1 | branched chain amino acid ABC transporter permease LivM | - |
| PS048_RS01520 (319228) | 319228..319995 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19679.53 Da Isoelectric Point: 6.3293
>T271845 WP_273785535.1 NZ_CP117647:314543-315070 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQEQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQEQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|