Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 92693..93240 Replicon plasmid pEA17_1
Accession NZ_CP117644
Organism Escherichia albertii strain BIA_17

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag PS043_RS24800 Protein ID WP_273817137.1
Coordinates 92962..93240 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag PS043_RS24795 Protein ID WP_273817108.1
Coordinates 92693..92962 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS043_RS24755 (87862) 87862..88074 + 213 WP_001299730.1 ANR family transcriptional regulator -
PS043_RS24760 (88320) 88320..88394 + 75 Protein_102 endonuclease -
PS043_RS24765 (88728) 88728..89425 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
- (89440) 89440..89488 - 49 NuclAT_1 - -
- (89440) 89440..89488 - 49 NuclAT_1 - -
- (89440) 89440..89488 - 49 NuclAT_1 - -
- (89440) 89440..89488 - 49 NuclAT_1 - -
PS043_RS24770 (89532) 89532..89681 + 150 WP_001312851.1 Hok/Gef family protein -
PS043_RS24775 (89965) 89965..90222 + 258 WP_000083845.1 replication regulatory protein RepA -
PS043_RS24780 (90239) 90239..90490 - 252 WP_223195197.1 replication protein RepA -
PS043_RS24785 (90481) 90481..90528 + 48 WP_229471593.1 hypothetical protein -
PS043_RS24790 (91004) 91004..91780 + 777 WP_273817107.1 plasmid replication initiator RepA -
PS043_RS24795 (92693) 92693..92962 + 270 WP_273817108.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PS043_RS24800 (92962) 92962..93240 + 279 WP_273817137.1 type II toxin-antitoxin system toxin YacB Toxin
PS043_RS24805 (93250) 93250..93671 - 422 Protein_111 ATP-binding protein -
PS043_RS24810 (93671) 93671..94045 - 375 Protein_112 IS21 family transposase -
PS043_RS24815 (94142) 94142..95761 + 1620 WP_273817109.1 ISL3 family transposase -
PS043_RS24820 (95812) 95812..96177 - 366 Protein_114 transposase -
PS043_RS24825 (96694) 96694..97537 - 844 Protein_115 9-O-acetyl-N-acetylneuraminic acid deacetylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sitABCD spvC / spvC / spvC / spvC / espK / nleA/espI / vat / iutA / iucD / iucC / iucB / iucA 1..132593 132593
- inside IScluster/Tn - - 88922..99917 10995


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10747.40 Da        Isoelectric Point: 8.4615

>T271838 WP_273817137.1 NZ_CP117644:92962-93240 [Escherichia albertii]
MEIFWTMLASLDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10193.53 Da        Isoelectric Point: 7.3210

>AT271838 WP_273817108.1 NZ_CP117644:92693-92962 [Escherichia albertii]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFHDQVEAGRQQLGRGDMLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References