Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 79408..80033 | Replicon | plasmid pEA17_1 |
Accession | NZ_CP117644 | ||
Organism | Escherichia albertii strain BIA_17 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PS043_RS24725 | Protein ID | WP_273817105.1 |
Coordinates | 79408..79806 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | PS043_RS24730 | Protein ID | WP_000450520.1 |
Coordinates | 79806..80033 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS043_RS24710 (75733) | 75733..76230 | + | 498 | WP_273817104.1 | entry exclusion protein | - |
PS043_RS24715 (76262) | 76262..76993 | + | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
PS043_RS24720 (77246) | 77246..79399 | + | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
PS043_RS24725 (79408) | 79408..79806 | - | 399 | WP_273817105.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PS043_RS24730 (79806) | 79806..80033 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sitABCD | spvC / spvC / spvC / spvC / espK / nleA/espI / vat / iutA / iucD / iucC / iucB / iucA | 1..132593 | 132593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14917.15 Da Isoelectric Point: 7.8605
>T271837 WP_273817105.1 NZ_CP117644:c79806-79408 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHSRSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHSRSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|