Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yeeU/CbtA-CbeA
Location 4329070..4329777 Replicon chromosome
Accession NZ_CP117643
Organism Escherichia albertii strain BIA_17

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag PS043_RS21755 Protein ID WP_161537416.1
Coordinates 4329436..4329777 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3L1KVZ6
Locus tag PS043_RS21750 Protein ID WP_000939437.1
Coordinates 4329070..4329405 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS043_RS21720 (4325019) 4325019..4325237 - 219 WP_273816597.1 AlpA family phage regulatory protein -
PS043_RS21725 (4325355) 4325355..4325969 - 615 WP_161537419.1 inovirus Gp2 family protein -
PS043_RS21730 (4326562) 4326562..4327206 + 645 WP_237579909.1 hypothetical protein -
PS043_RS21735 (4327266) 4327266..4327466 + 201 WP_273816598.1 hypothetical protein -
PS043_RS21740 (4327749) 4327749..4328567 + 819 WP_161537418.1 DUF932 domain-containing protein -
PS043_RS21745 (4328597) 4328597..4329070 + 474 Protein_4258 DNA repair protein RadC -
PS043_RS21750 (4329070) 4329070..4329405 + 336 WP_000939437.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PS043_RS21755 (4329436) 4329436..4329777 + 342 WP_161537416.1 TA system toxin CbtA family protein Toxin
PS043_RS21760 (4329892) 4329892..4330725 + 834 WP_161537415.1 DUF4942 domain-containing protein -
PS043_RS21765 (4330802) 4330802..4331050 + 249 WP_024187601.1 ribbon-helix-helix domain-containing protein -
PS043_RS21770 (4331054) 4331054..4331329 + 276 WP_161537414.1 type II toxin-antitoxin system RelE/ParE family toxin -
PS043_RS21775 (4331448) 4331448..4332239 + 792 WP_161537413.1 helix-turn-helix transcriptional regulator -
PS043_RS21780 (4332511) 4332511..4333494 + 984 WP_161537412.1 restriction endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - espK / espF / escG / escF / cesD2 / espB / espD / espA / sepL / escD / eae / cesT / tir / map / cesF / espH / sepQ/escQ / escO / escN / escV / cesL / sepZ/espZ / escI / escJ / sepD / escC / cesD / etgA / escU / escT / escS / escR / escL / escK / cesAB / escE / espG 4328765..4380186 51421


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-110)

Antitoxin

Antitoxin CbeA

(10-110)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13049.02 Da        Isoelectric Point: 9.5454

>T271833 WP_161537416.1 NZ_CP117643:4329436-4329777 [Escherichia albertii]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGQLRRCHNTTAR

Download         Length: 342 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12556.56 Da        Isoelectric Point: 7.6977

>AT271833 WP_000939437.1 NZ_CP117643:4329070-4329405 [Escherichia albertii]
MLQKDKVMQQEWGLPCTVTPRFTARLVQERHNLHYLADRAAITGKFSSPDLLHIDQAFPVLMKQLELKLADGELSPCQQR
TVTLYAKGLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3L1KVZ6

References