Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3530973..3531591 | Replicon | chromosome |
| Accession | NZ_CP117643 | ||
| Organism | Escherichia albertii strain BIA_17 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS043_RS17800 | Protein ID | WP_001280991.1 |
| Coordinates | 3531373..3531591 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS043_RS17795 | Protein ID | WP_000344798.1 |
| Coordinates | 3530973..3531347 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS043_RS17785 (3526053) | 3526053..3527246 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS043_RS17790 (3527269) | 3527269..3530418 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS043_RS17795 (3530973) | 3530973..3531347 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS043_RS17800 (3531373) | 3531373..3531591 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS043_RS17805 (3531768) | 3531768..3532325 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| PS043_RS17810 (3532432) | 3532432..3532902 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| PS043_RS17815 (3533066) | 3533066..3534616 | + | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| PS043_RS17820 (3534654) | 3534654..3535007 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS043_RS17830 (3535388) | 3535388..3535699 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| PS043_RS17835 (3535729) | 3535729..3536301 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271826 WP_001280991.1 NZ_CP117643:3531373-3531591 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271826 WP_000344798.1 NZ_CP117643:3530973-3531347 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|