Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1979218..1979808 | Replicon | chromosome |
Accession | NZ_CP117643 | ||
Organism | Escherichia albertii strain BIA_17 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | PS043_RS09910 | Protein ID | WP_059225520.1 |
Coordinates | 1979476..1979808 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | PS043_RS09905 | Protein ID | WP_059225519.1 |
Coordinates | 1979218..1979475 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS043_RS09885 (1975780) | 1975780..1976477 | + | 698 | WP_094096600.1 | IS1-like element IS1A family transposase | - |
PS043_RS09890 (1976488) | 1976488..1977597 | - | 1110 | WP_273816966.1 | hypothetical protein | - |
PS043_RS09895 (1978198) | 1978198..1978668 | + | 471 | WP_059225518.1 | hypothetical protein | - |
PS043_RS09900 (1978665) | 1978665..1978870 | + | 206 | Protein_1936 | helix-turn-helix transcriptional regulator | - |
PS043_RS09905 (1979218) | 1979218..1979475 | + | 258 | WP_059225519.1 | hypothetical protein | Antitoxin |
PS043_RS09910 (1979476) | 1979476..1979808 | + | 333 | WP_059225520.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PS043_RS09915 (1979921) | 1979921..1980298 | + | 378 | WP_273816967.1 | hypothetical protein | - |
PS043_RS09920 (1980616) | 1980616..1981500 | + | 885 | WP_059225521.1 | integrase domain-containing protein | - |
PS043_RS09925 (1981596) | 1981596..1981883 | - | 288 | WP_059225522.1 | hypothetical protein | - |
PS043_RS09930 (1982096) | 1982096..1982224 | - | 129 | WP_273816968.1 | hypothetical protein | - |
PS043_RS09935 (1982842) | 1982842..1984104 | - | 1263 | WP_059225524.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | rhs/PAAR | 1951928..1999269 | 47341 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11777.59 Da Isoelectric Point: 8.0291
>T271819 WP_059225520.1 NZ_CP117643:1979476-1979808 [Escherichia albertii]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|