Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 910714..911365 | Replicon | chromosome |
| Accession | NZ_CP117643 | ||
| Organism | Escherichia albertii strain BIA_17 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PS043_RS04520 | Protein ID | WP_161537425.1 |
| Coordinates | 910961..911365 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PS043_RS04515 | Protein ID | WP_000354046.1 |
| Coordinates | 910714..910980 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS043_RS04490 (906425) | 906425..907858 | - | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
| PS043_RS04495 (907903) | 907903..908214 | + | 312 | WP_001182937.1 | N(4)-acetylcytidine aminohydrolase | - |
| PS043_RS04500 (908382) | 908382..909041 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| PS043_RS04505 (909482) | 909482..910462 | - | 981 | WP_125060505.1 | tRNA-modifying protein YgfZ | - |
| PS043_RS04510 (910494) | 910494..910724 | + | 231 | WP_000181267.1 | hypothetical protein | - |
| PS043_RS04515 (910714) | 910714..910980 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PS043_RS04520 (910961) | 910961..911365 | + | 405 | WP_161537425.1 | protein YgfX | Toxin |
| PS043_RS04525 (911404) | 911404..911925 | - | 522 | WP_161537424.1 | flavodoxin FldB | - |
| PS043_RS04530 (912037) | 912037..912933 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PS043_RS04535 (912958) | 912958..913668 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PS043_RS04540 (913674) | 913674..915407 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15819.70 Da Isoelectric Point: 10.7510
>T271817 WP_161537425.1 NZ_CP117643:910961-911365 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVSAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVSAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |