Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 34465..35066 Replicon plasmid pEA18_2
Accession NZ_CP117639
Organism Escherichia albertii strain BIA_18

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PS040_RS24995 Protein ID WP_001216034.1
Coordinates 34686..35066 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A765X875
Locus tag PS040_RS24990 Protein ID WP_032271830.1
Coordinates 34465..34686 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS040_RS24945 (PS040_24945) 29639..29899 + 261 WP_001554875.1 hypothetical protein -
PS040_RS24950 (PS040_24950) 29976..30209 + 234 WP_000517420.1 hypothetical protein -
PS040_RS24955 (PS040_24955) 30388..30681 + 294 WP_000269004.1 hypothetical protein -
PS040_RS24960 (PS040_24960) 30688..31062 + 375 WP_001749397.1 hypothetical protein -
PS040_RS24965 (PS040_24965) 31044..31976 + 933 WP_273784096.1 hypothetical protein -
PS040_RS24970 (PS040_24970) 31973..32335 + 363 WP_062905072.1 hypothetical protein -
PS040_RS24975 (PS040_24975) 32998..33249 + 252 WP_001667237.1 DNA polymerase III subunit theta -
PS040_RS24980 (PS040_24980) 33256..33828 - 573 WP_001133670.1 hypothetical protein -
PS040_RS24985 (PS040_24985) 34003..34392 + 390 WP_000506730.1 S24 family peptidase -
PS040_RS24990 (PS040_24990) 34465..34686 + 222 WP_032271830.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PS040_RS24995 (PS040_24995) 34686..35066 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PS040_RS25000 (PS040_25000) 35071..35250 + 180 WP_024262170.1 hypothetical protein -
PS040_RS25005 (PS040_25005) 35278..36321 + 1044 WP_273784097.1 DUF968 domain-containing protein -
PS040_RS25010 (PS040_25010) 36410..36862 + 453 WP_032165150.1 Late promoter-activating protein -
PS040_RS25015 (PS040_25015) 36899..38074 - 1176 WP_000942666.1 RNA-guided endonuclease TnpB family protein -
PS040_RS25020 (PS040_25020) 38282..39475 + 1194 WP_273784098.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99793 99793
- flank IS/Tn - - 36899..38074 1175


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T271811 WP_001216034.1 NZ_CP117639:34686-35066 [Escherichia albertii]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8161.16 Da        Isoelectric Point: 5.1106

>AT271811 WP_032271830.1 NZ_CP117639:34465-34686 [Escherichia albertii]
MRSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A765X875

References