Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5414..5939 Replicon plasmid pEA18_1
Accession NZ_CP117638
Organism Escherichia albertii strain BIA_18

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag PS040_RS23985 Protein ID WP_001159871.1
Coordinates 5634..5939 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag PS040_RS23980 Protein ID WP_000813639.1
Coordinates 5414..5632 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS040_RS23965 (2246) 2246..2656 - 411 WP_256878411.1 subtilase family AB5 toxin binding subunit -
PS040_RS23970 (2766) 2766..3491 - 726 WP_256878412.1 enterotoxin A family protein -
PS040_RS23975 (3813) 3813..4941 + 1129 Protein_3 IS3 family transposase -
PS040_RS23980 (5414) 5414..5632 + 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PS040_RS23985 (5634) 5634..5939 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
PS040_RS23990 (5940) 5940..6748 + 809 Protein_6 site-specific integrase -
PS040_RS23995 (6928) 6928..7572 + 645 WP_001144036.1 ParA family protein -
PS040_RS24000 (7659) 7659..7967 + 309 WP_000030204.1 molecular chaperone GroEL -
PS040_RS24005 (8379) 8379..9359 + 981 WP_256878413.1 plasmid segregation protein ParM -
PS040_RS24010 (9352) 9352..9768 + 417 WP_273775112.1 plasmid partitioning/stability family protein -
PS040_RS24015 (9770) 9770..9979 - 210 Protein_11 DUF4113 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - espL2 / espL2 / iucA / iucB / iucC / iucD / iutA / gspL / gspH / gspG / vat 1..144030 144030


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T271810 WP_001159871.1 NZ_CP117638:5634-5939 [Escherichia albertii]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT271810 WP_000813639.1 NZ_CP117638:5414-5632 [Escherichia albertii]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References