Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4202396..4203069 | Replicon | chromosome |
| Accession | NZ_CP117637 | ||
| Organism | Escherichia albertii strain BIA_18 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A8H9EW26 |
| Locus tag | PS040_RS20770 | Protein ID | WP_059273492.1 |
| Coordinates | 4202396..4202737 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | PS040_RS20775 | Protein ID | WP_273783921.1 |
| Coordinates | 4202758..4203069 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS040_RS20755 (4199396) | 4199396..4199953 | - | 558 | WP_000955766.1 | hypothetical protein | - |
| PS040_RS20760 (4200284) | 4200284..4200820 | - | 537 | WP_059221727.1 | hypothetical protein | - |
| PS040_RS20765 (4201125) | 4201125..4202132 | - | 1008 | WP_059273491.1 | restriction endonuclease | - |
| PS040_RS20770 (4202396) | 4202396..4202737 | - | 342 | WP_059273492.1 | TA system toxin CbtA family protein | Toxin |
| PS040_RS20775 (4202758) | 4202758..4203069 | - | 312 | WP_273783921.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS040_RS20780 (4203109) | 4203109..4203650 | - | 542 | Protein_4064 | DNA repair protein RadC | - |
| PS040_RS20785 (4203663) | 4203663..4204103 | - | 441 | WP_059273494.1 | antirestriction protein | - |
| PS040_RS20790 (4204134) | 4204134..4204373 | - | 240 | Protein_4066 | DUF932 domain-containing protein | - |
| PS040_RS20795 (4204413) | 4204413..4204637 | + | 225 | WP_236926507.1 | AlpA family transcriptional regulator | - |
| PS040_RS20800 (4205059) | 4205059..4207134 | + | 2076 | WP_059273495.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | vat / nleE / nleB1 | 4190068..4208853 | 18785 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12778.74 Da Isoelectric Point: 8.0324
>T271807 WP_059273492.1 NZ_CP117637:c4202737-4202396 [Escherichia albertii]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQTTGLLKRNRISAAR
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQTTGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|