Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3592341..3592959 | Replicon | chromosome |
| Accession | NZ_CP117637 | ||
| Organism | Escherichia albertii strain BIA_18 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PS040_RS17850 | Protein ID | WP_001280991.1 |
| Coordinates | 3592741..3592959 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | PS040_RS17845 | Protein ID | WP_000344798.1 |
| Coordinates | 3592341..3592715 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS040_RS17835 (3587421) | 3587421..3588614 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PS040_RS17840 (3588637) | 3588637..3591786 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| PS040_RS17845 (3592341) | 3592341..3592715 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| PS040_RS17850 (3592741) | 3592741..3592959 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PS040_RS17855 (3593136) | 3593136..3593693 | + | 558 | WP_204628716.1 | maltose O-acetyltransferase | - |
| PS040_RS17860 (3593801) | 3593801..3594271 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| PS040_RS17865 (3594435) | 3594435..3595985 | + | 1551 | WP_054411428.1 | EAL domain-containing protein | - |
| PS040_RS17870 (3596023) | 3596023..3596376 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| PS040_RS17880 (3596757) | 3596757..3597068 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| PS040_RS17885 (3597098) | 3597098..3597670 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271801 WP_001280991.1 NZ_CP117637:3592741-3592959 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271801 WP_000344798.1 NZ_CP117637:3592341-3592715 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|