Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2510062..2510666 | Replicon | chromosome |
| Accession | NZ_CP117637 | ||
| Organism | Escherichia albertii strain BIA_18 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | PS040_RS12530 | Protein ID | WP_273782133.1 |
| Coordinates | 2510280..2510666 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | PS040_RS12525 | Protein ID | WP_001195490.1 |
| Coordinates | 2510062..2510283 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS040_RS12505 (2505163) | 2505163..2506800 | + | 1638 | WP_273782131.1 | hypothetical protein | - |
| PS040_RS12510 (2506818) | 2506818..2507105 | + | 288 | WP_062863912.1 | DUF2523 family protein | - |
| PS040_RS12515 (2507117) | 2507117..2508175 | + | 1059 | WP_273782132.1 | zonular occludens toxin domain-containing protein | - |
| PS040_RS12520 (2508172) | 2508172..2509431 | + | 1260 | WP_062863914.1 | type II secretion system protein GspD | - |
| PS040_RS12525 (2510062) | 2510062..2510283 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PS040_RS12530 (2510280) | 2510280..2510666 | + | 387 | WP_273782133.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14449.43 Da Isoelectric Point: 9.0256
>T271799 WP_273782133.1 NZ_CP117637:2510280-2510666 [Escherichia albertii]
MIWVSAQEVIAFHARILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGTRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHARILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGTRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|