Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 892896..893547 | Replicon | chromosome |
Accession | NZ_CP117637 | ||
Organism | Escherichia albertii strain BIA_18 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B1EG01 |
Locus tag | PS040_RS04325 | Protein ID | WP_000244763.1 |
Coordinates | 893143..893547 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS040_RS04320 | Protein ID | WP_000354046.1 |
Coordinates | 892896..893162 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS040_RS04300 (888606) | 888606..890039 | - | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
PS040_RS04305 (890084) | 890084..890395 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PS040_RS04310 (890563) | 890563..891222 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
PS040_RS04315 (891663) | 891663..892643 | - | 981 | WP_273783069.1 | tRNA-modifying protein YgfZ | - |
PS040_RS04320 (892896) | 892896..893162 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS040_RS04325 (893143) | 893143..893547 | + | 405 | WP_000244763.1 | protein YgfX | Toxin |
PS040_RS04330 (893586) | 893586..894107 | - | 522 | WP_273783070.1 | flavodoxin FldB | - |
PS040_RS04335 (894219) | 894219..895115 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PS040_RS04340 (895140) | 895140..895850 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS040_RS04345 (895856) | 895856..897589 | + | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271793 WP_000244763.1 NZ_CP117637:893143-893547 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6P9B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |