Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 285245..286045 | Replicon | chromosome |
| Accession | NZ_CP117637 | ||
| Organism | Escherichia albertii strain BIA_18 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | PS040_RS01330 | Protein ID | WP_273782756.1 |
| Coordinates | 285518..286045 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | PS040_RS01325 | Protein ID | WP_001277104.1 |
| Coordinates | 285245..285511 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS040_RS01300 (280966) | 280966..281820 | - | 855 | WP_273782751.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| PS040_RS01305 (281813) | 281813..282559 | - | 747 | WP_000151888.1 | PTS sugar transporter subunit IIC | - |
| PS040_RS01310 (282576) | 282576..283061 | - | 486 | WP_000029259.1 | PTS sugar transporter subunit IIB | - |
| PS040_RS01315 (283068) | 283068..283469 | - | 402 | WP_273782753.1 | PTS sugar transporter subunit IIA | - |
| PS040_RS01320 (283992) | 283992..285095 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| PS040_RS01325 (285245) | 285245..285511 | + | 267 | WP_001277104.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| PS040_RS01330 (285518) | 285518..286045 | + | 528 | WP_273782756.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| PS040_RS01335 (286042) | 286042..286425 | - | 384 | WP_059270572.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| PS040_RS01340 (286849) | 286849..287958 | + | 1110 | WP_000827693.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PS040_RS01345 (288006) | 288006..288932 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PS040_RS01350 (288929) | 288929..290206 | + | 1278 | WP_059218996.1 | branched chain amino acid ABC transporter permease LivM | - |
| PS040_RS01355 (290203) | 290203..290970 | + | 768 | WP_059218997.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19539.45 Da Isoelectric Point: 6.3254
>T271790 WP_273782756.1 NZ_CP117637:285518-286045 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPECQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYLSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCSNTPECQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYLSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|