Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 57040..57641 Replicon plasmid pEA22_2
Accession NZ_CP117630
Organism Escherichia albertii strain BIA_22

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag PS041_RS25510 Protein ID WP_001216045.1
Coordinates 57040..57420 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PS041_RS25515 Protein ID WP_001190712.1
Coordinates 57420..57641 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS041_RS25480 (PS041_25480) 52166..52267 - 102 Protein_51 transcriptional regulator -
PS041_RS25485 (PS041_25485) 52481..53965 - 1485 WP_000124159.1 hypothetical protein -
PS041_RS25490 (PS041_25490) 53965..55158 - 1194 WP_139496163.1 terminase -
PS041_RS25495 (PS041_25495) 55244..55696 - 453 WP_001326849.1 late promoter-activating protein -
PS041_RS25500 (PS041_25500) 55785..56828 - 1044 WP_023356283.1 DUF968 domain-containing protein -
PS041_RS25505 (PS041_25505) 56856..57035 - 180 WP_000113019.1 hypothetical protein -
PS041_RS25510 (PS041_25510) 57040..57420 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PS041_RS25515 (PS041_25515) 57420..57641 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PS041_RS25520 (PS041_25520) 57714..58103 - 390 WP_000506730.1 S24 family peptidase -
PS041_RS25525 (PS041_25525) 58277..58849 + 573 WP_273825573.1 DNA-binding protein -
PS041_RS25530 (PS041_25530) 58856..59107 - 252 WP_001667237.1 DNA polymerase III subunit theta -
PS041_RS25535 (PS041_25535) 59770..60132 - 363 WP_001261544.1 hypothetical protein -
PS041_RS25540 (PS041_25540) 60503..61198 - 696 Protein_63 hypothetical protein -
PS041_RS25545 (PS041_25545) 61393..61899 - 507 WP_000021759.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..95979 95979


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T271781 WP_001216045.1 NZ_CP117630:c57420-57040 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT271781 WP_001190712.1 NZ_CP117630:c57641-57420 [Escherichia albertii]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References