Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 83229..83776 Replicon plasmid pEA22_1
Accession NZ_CP117629
Organism Escherichia albertii strain BIA_22

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag PS041_RS24835 Protein ID WP_001384452.1
Coordinates 83229..83507 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag PS041_RS24840 Protein ID WP_273818329.1
Coordinates 83507..83776 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS041_RS24800 (78718) 78718..79035 - 318 Protein_82 integrase core domain-containing protein -
PS041_RS24805 (79052) 79052..79777 - 726 Protein_83 transposase -
PS041_RS24810 (79829) 79829..80611 - 783 WP_001317493.1 IS21-like element IS100kyp family helper ATPase IstB -
PS041_RS24815 (80608) 80608..81630 - 1023 WP_226109773.1 IS21-like element IS100 family transposase -
PS041_RS24820 (81717) 81717..82262 - 546 Protein_86 transposase family protein -
PS041_RS24825 (82358) 82358..82732 + 375 Protein_87 IS21 family transposase -
PS041_RS24830 (82732) 82732..83231 + 500 Protein_88 ATP-binding protein -
PS041_RS24835 (83229) 83229..83507 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
PS041_RS24840 (83507) 83507..83776 - 270 WP_273818329.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PS041_RS24845 (84689) 84689..85546 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
PS041_RS24850 (85539) 85539..86021 - 483 WP_001273588.1 hypothetical protein -
PS041_RS24855 (86014) 86014..86061 - 48 WP_229471593.1 hypothetical protein -
PS041_RS24860 (86052) 86052..86303 + 252 WP_223195197.1 replication protein RepA -
PS041_RS24865 (86320) 86320..86577 - 258 WP_258141648.1 replication regulatory protein RepA -
PS041_RS24870 (86861) 86861..87010 - 150 WP_001312851.1 Hok/Gef family protein -
- (87054) 87054..87115 + 62 NuclAT_1 - -
- (87054) 87054..87115 + 62 NuclAT_1 - -
- (87054) 87054..87115 + 62 NuclAT_1 - -
- (87054) 87054..87115 + 62 NuclAT_1 - -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / vat / nleA/espI / espK / iutA / iucD / iucC / iucB / iucA 1..152064 152064


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T271779 WP_001384452.1 NZ_CP117629:c83507-83229 [Escherichia albertii]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10265.60 Da        Isoelectric Point: 6.7263

>AT271779 WP_273818329.1 NZ_CP117629:c83776-83507 [Escherichia albertii]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFHDQVEAGRQQLERGDMLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure

References