Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3726744..3727395 | Replicon | chromosome |
Accession | NZ_CP117628 | ||
Organism | Escherichia albertii strain BIA_22 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B1EG01 |
Locus tag | PS041_RS18620 | Protein ID | WP_000244763.1 |
Coordinates | 3726744..3727148 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS041_RS18625 | Protein ID | WP_000354046.1 |
Coordinates | 3727129..3727395 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS041_RS18600 (3722707) | 3722707..3724440 | - | 1734 | WP_273785787.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PS041_RS18605 (3724446) | 3724446..3725156 | - | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS041_RS18610 (3725181) | 3725181..3726077 | - | 897 | WP_273824434.1 | site-specific tyrosine recombinase XerD | - |
PS041_RS18615 (3726189) | 3726189..3726710 | + | 522 | WP_059221135.1 | flavodoxin FldB | - |
PS041_RS18620 (3726744) | 3726744..3727148 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
PS041_RS18625 (3727129) | 3727129..3727395 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS041_RS18630 (3727385) | 3727385..3727615 | - | 231 | WP_000181267.1 | hypothetical protein | - |
PS041_RS18635 (3727647) | 3727647..3728627 | + | 981 | WP_131109271.1 | tRNA-modifying protein YgfZ | - |
PS041_RS18640 (3729068) | 3729068..3729727 | - | 660 | WP_000250281.1 | hemolysin III family protein | - |
PS041_RS18645 (3729895) | 3729895..3730206 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PS041_RS18650 (3730251) | 3730251..3731684 | + | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271772 WP_000244763.1 NZ_CP117628:c3727148-3726744 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6P9B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |