Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1101071..1101689 | Replicon | chromosome |
Accession | NZ_CP117628 | ||
Organism | Escherichia albertii strain BIA_22 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PS041_RS05490 | Protein ID | WP_001280991.1 |
Coordinates | 1101071..1101289 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | PS041_RS05495 | Protein ID | WP_000344798.1 |
Coordinates | 1101315..1101689 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS041_RS05460 (1096964) | 1096964..1097275 | - | 312 | WP_000409915.1 | MGMT family protein | - |
PS041_RS05470 (1097656) | 1097656..1098008 | + | 353 | Protein_1062 | DUF1428 family protein | - |
PS041_RS05475 (1098046) | 1098046..1099596 | - | 1551 | WP_273825077.1 | EAL domain-containing protein | - |
PS041_RS05480 (1099760) | 1099760..1100230 | - | 471 | WP_000136188.1 | YlaC family protein | - |
PS041_RS05485 (1100337) | 1100337..1100894 | - | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
PS041_RS05490 (1101071) | 1101071..1101289 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PS041_RS05495 (1101315) | 1101315..1101689 | - | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
PS041_RS05500 (1102244) | 1102244..1105393 | - | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
PS041_RS05505 (1105416) | 1105416..1106609 | - | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1095411..1096784 | 1373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T271761 WP_001280991.1 NZ_CP117628:c1101289-1101071 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT271761 WP_000344798.1 NZ_CP117628:c1101689-1101315 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|