Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 539516..540092 | Replicon | chromosome |
Accession | NZ_CP117628 | ||
Organism | Escherichia albertii strain BIA_22 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | PS041_RS02710 | Protein ID | WP_024164652.1 |
Coordinates | 539516..539803 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | PS041_RS02715 | Protein ID | WP_000063163.1 |
Coordinates | 539790..540092 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS041_RS02695 (535081) | 535081..536481 | - | 1401 | WP_059254411.1 | restriction endonuclease subunit S | - |
PS041_RS02700 (536471) | 536471..538090 | - | 1620 | WP_044717122.1 | class I SAM-dependent DNA methyltransferase | - |
PS041_RS02705 (538154) | 538154..539319 | - | 1166 | Protein_523 | restriction endonuclease | - |
PS041_RS02710 (539516) | 539516..539803 | + | 288 | WP_024164652.1 | BrnT family toxin | Toxin |
PS041_RS02715 (539790) | 539790..540092 | + | 303 | WP_000063163.1 | BrnA antitoxin family protein | Antitoxin |
PS041_RS02720 (540126) | 540126..541082 | - | 957 | WP_273824881.1 | GTPase | - |
PS041_RS02725 (541093) | 541093..541296 | - | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
PS041_RS02730 (541416) | 541416..543566 | - | 2151 | WP_273824883.1 | pyruvate/proton symporter BtsT | - |
PS041_RS02735 (544088) | 544088..544386 | + | 299 | Protein_529 | Tar ligand binding domain-containing protein | - |
PS041_RS02740 (544410) | 544410..544541 | + | 132 | WP_024164650.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11128.57 Da Isoelectric Point: 6.9903
>T271759 WP_024164652.1 NZ_CP117628:539516-539803 [Escherichia albertii]
MPMEFEWDANKAKSNQVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
MPMEFEWDANKAKSNQVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|