Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 34465..34987 Replicon plasmid pEA24_4
Accession NZ_CP117624
Organism Escherichia albertii strain BIA_24

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PS039_RS25540 Protein ID WP_000220560.1
Coordinates 34706..34987 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PS039_RS25535 Protein ID WP_000121743.1
Coordinates 34465..34716 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS039_RS25515 (PS039_25515) 30351..30911 + 561 WP_021573890.1 recombinase family protein -
PS039_RS25520 (PS039_25520) 31416..31772 - 357 WP_000456533.1 DNA distortion polypeptide 3 -
PS039_RS25525 (PS039_25525) 31909..32355 - 447 WP_001074386.1 hypothetical protein -
PS039_RS25530 (PS039_25530) 32395..33231 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
PS039_RS25535 (PS039_25535) 34465..34716 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PS039_RS25540 (PS039_25540) 34706..34987 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS039_RS25545 (PS039_25545) 35133..35456 + 324 WP_001181903.1 hypothetical protein -
PS039_RS25550 (PS039_25550) 35501..35746 + 246 WP_000356546.1 hypothetical protein -
PS039_RS25555 (PS039_25555) 35736..35951 + 216 WP_001180116.1 hypothetical protein -
PS039_RS25560 (PS039_25560) 36044..36373 + 330 WP_001556724.1 hypothetical protein -
PS039_RS25565 (PS039_25565) 36416..36595 + 180 WP_000439078.1 hypothetical protein -
PS039_RS25570 (PS039_25570) 36665..36814 + 150 WP_000003880.1 hypothetical protein -
PS039_RS25575 (PS039_25575) 36827..37099 + 273 WP_000160399.1 hypothetical protein -
PS039_RS25580 (PS039_25580) 37425..37970 + 546 WP_000757693.1 DNA distortion polypeptide 1 -
PS039_RS25585 (PS039_25585) 37973..39139 + 1167 WP_000539530.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..43633 43633


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T271754 WP_000220560.1 NZ_CP117624:34706-34987 [Escherichia albertii]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT271754 WP_000121743.1 NZ_CP117624:34465-34716 [Escherichia albertii]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References