Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 63486..64087 Replicon plasmid pEA24_3
Accession NZ_CP117623
Organism Escherichia albertii strain BIA_24

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PS039_RS25245 Protein ID WP_001216034.1
Coordinates 63707..64087 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PS039_RS25240 Protein ID WP_001190712.1
Coordinates 63486..63707 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS039_RS25200 (PS039_25200) 58788..58976 + 189 WP_000797279.1 hypothetical protein -
PS039_RS25205 (PS039_25205) 58978..59156 + 179 Protein_64 hypothetical protein -
PS039_RS25210 (PS039_25210) 59161..59493 + 333 WP_155120833.1 hypothetical protein -
PS039_RS25215 (PS039_25215) 59490..59624 + 135 Protein_66 hypothetical protein -
PS039_RS25220 (PS039_25220) 59838..60101 + 264 Protein_67 hypothetical protein -
PS039_RS25225 (PS039_25225) 60782..61144 + 363 WP_061356936.1 hypothetical protein -
PS039_RS25230 (PS039_25230) 62220..62576 - 357 WP_032167088.1 hypothetical protein -
PS039_RS25235 (PS039_25235) 63024..63413 + 390 WP_000506730.1 S24 family peptidase -
PS039_RS25240 (PS039_25240) 63486..63707 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PS039_RS25245 (PS039_25245) 63707..64087 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PS039_RS25250 (PS039_25250) 64092..64271 + 180 WP_000113018.1 hypothetical protein -
PS039_RS25255 (PS039_25255) 64299..65342 + 1044 WP_061356935.1 DUF968 domain-containing protein -
PS039_RS25260 (PS039_25260) 65431..65883 + 453 WP_001326849.1 late promoter-activating protein -
PS039_RS25265 (PS039_25265) 65969..67162 + 1194 WP_032167084.1 terminase -
PS039_RS25270 (PS039_25270) 67162..68646 + 1485 WP_000124159.1 hypothetical protein -
PS039_RS25275 (PS039_25275) 68730..68960 + 231 Protein_78 ash family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..81931 81931


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T271753 WP_001216034.1 NZ_CP117623:63707-64087 [Escherichia albertii]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT271753 WP_001190712.1 NZ_CP117623:63486-63707 [Escherichia albertii]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References