Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3819140..3819938 | Replicon | chromosome |
| Accession | NZ_CP117620 | ||
| Organism | Escherichia albertii strain BIA_24 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0F3UPG9 |
| Locus tag | PS039_RS18510 | Protein ID | WP_000854698.1 |
| Coordinates | 3819561..3819938 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0F3T7G0 |
| Locus tag | PS039_RS18505 | Protein ID | WP_000017094.1 |
| Coordinates | 3819140..3819514 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS039_RS18470 (3815786) | 3815786..3816241 | + | 456 | WP_000581506.1 | IrmA family protein | - |
| PS039_RS18475 (3816342) | 3816342..3816550 | + | 209 | Protein_3594 | DUF905 family protein | - |
| PS039_RS18480 (3816651) | 3816651..3817472 | + | 822 | WP_001761104.1 | DUF932 domain-containing protein | - |
| PS039_RS18485 (3817472) | 3817472..3817672 | + | 201 | WP_001420888.1 | hypothetical protein | - |
| PS039_RS18490 (3817810) | 3817810..3818283 | + | 474 | WP_000855084.1 | antirestriction protein | - |
| PS039_RS18495 (3818299) | 3818299..3818775 | + | 477 | WP_025380661.1 | RadC family protein | - |
| PS039_RS18500 (3818844) | 3818844..3819065 | + | 222 | WP_001220316.1 | DUF987 domain-containing protein | - |
| PS039_RS18505 (3819140) | 3819140..3819514 | + | 375 | WP_000017094.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS039_RS18510 (3819561) | 3819561..3819938 | + | 378 | WP_000854698.1 | TA system toxin CbtA family protein | Toxin |
| PS039_RS18515 (3819935) | 3819935..3820423 | + | 489 | WP_001054226.1 | DUF5983 family protein | - |
| PS039_RS18520 (3820435) | 3820435..3820632 | + | 198 | WP_000839251.1 | DUF957 domain-containing protein | - |
| PS039_RS18525 (3820717) | 3820717..3821559 | + | 843 | WP_001280439.1 | DUF4942 domain-containing protein | - |
| PS039_RS18530 (3821894) | 3821894..3822772 | - | 879 | WP_044712664.1 | DUF2220 family protein | - |
| PS039_RS18535 (3822769) | 3822769..3824007 | - | 1239 | WP_000046330.1 | hypothetical protein | - |
| PS039_RS18540 (3824007) | 3824007..3824630 | - | 624 | WP_059218103.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13975.94 Da Isoelectric Point: 7.9087
>T271745 WP_000854698.1 NZ_CP117620:3819561-3819938 [Escherichia albertii]
MKTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR
MKTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13732.42 Da Isoelectric Point: 5.4488
>AT271745 WP_000017094.1 NZ_CP117620:3819140-3819514 [Escherichia albertii]
VSGTLHETNYPNDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSGTLHETNYPNDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F3UPG9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F3T7G0 |