Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3694142..3694793 | Replicon | chromosome |
Accession | NZ_CP117620 | ||
Organism | Escherichia albertii strain BIA_24 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B1EG01 |
Locus tag | PS039_RS17870 | Protein ID | WP_000244763.1 |
Coordinates | 3694142..3694546 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PS039_RS17875 | Protein ID | WP_000354046.1 |
Coordinates | 3694527..3694793 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS039_RS17850 (3690100) | 3690100..3691833 | - | 1734 | WP_000813238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PS039_RS17855 (3691839) | 3691839..3692549 | - | 711 | WP_000748105.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PS039_RS17860 (3692574) | 3692574..3693470 | - | 897 | WP_273809596.1 | site-specific tyrosine recombinase XerD | - |
PS039_RS17865 (3693582) | 3693582..3694103 | + | 522 | WP_059235395.1 | flavodoxin FldB | - |
PS039_RS17870 (3694142) | 3694142..3694546 | - | 405 | WP_000244763.1 | protein YgfX | Toxin |
PS039_RS17875 (3694527) | 3694527..3694793 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PS039_RS17880 (3694783) | 3694783..3695013 | - | 231 | WP_273809598.1 | hypothetical protein | - |
PS039_RS17885 (3695045) | 3695045..3696025 | + | 981 | WP_273809600.1 | tRNA-modifying protein YgfZ | - |
PS039_RS17890 (3696466) | 3696466..3697125 | - | 660 | WP_059216760.1 | hemolysin III family protein | - |
PS039_RS17895 (3697293) | 3697293..3697604 | - | 312 | WP_001182937.1 | N(4)-acetylcytidine aminohydrolase | - |
PS039_RS17900 (3697649) | 3697649..3699082 | + | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15888.81 Da Isoelectric Point: 11.1732
>T271744 WP_000244763.1 NZ_CP117620:c3694546-3694142 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLRLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S6P9B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |