Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 498845..499552 | Replicon | chromosome |
| Accession | NZ_CP117620 | ||
| Organism | Escherichia albertii strain BIA_24 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | PS039_RS02440 | Protein ID | WP_161537416.1 |
| Coordinates | 499211..499552 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3L1KVZ6 |
| Locus tag | PS039_RS02435 | Protein ID | WP_000939437.1 |
| Coordinates | 498845..499180 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS039_RS02410 (494524) | 494524..495752 | + | 1229 | WP_273809172.1 | IS3-like element IS2 family transposase | - |
| PS039_RS02415 (496336) | 496336..496980 | + | 645 | WP_273810144.1 | hypothetical protein | - |
| PS039_RS02420 (497040) | 497040..497288 | + | 249 | WP_233991479.1 | hypothetical protein | - |
| PS039_RS02425 (497524) | 497524..498342 | + | 819 | WP_161537418.1 | DUF932 domain-containing protein | - |
| PS039_RS02430 (498372) | 498372..498845 | + | 474 | WP_161537417.1 | DNA repair protein RadC | - |
| PS039_RS02435 (498845) | 498845..499180 | + | 336 | WP_000939437.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PS039_RS02440 (499211) | 499211..499552 | + | 342 | WP_161537416.1 | TA system toxin CbtA family protein | Toxin |
| PS039_RS02445 (499667) | 499667..500500 | + | 834 | WP_161537415.1 | DUF4942 domain-containing protein | - |
| PS039_RS02450 (500577) | 500577..500825 | + | 249 | WP_024187601.1 | ribbon-helix-helix domain-containing protein | - |
| PS039_RS02455 (500829) | 500829..501104 | + | 276 | WP_161537414.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PS039_RS02460 (501223) | 501223..502014 | + | 792 | WP_161537413.1 | helix-turn-helix transcriptional regulator | - |
| PS039_RS02465 (502286) | 502286..503269 | + | 984 | WP_161537412.1 | restriction endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | vat | 494847..513092 | 18245 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13049.02 Da Isoelectric Point: 9.5454
>T271724 WP_161537416.1 NZ_CP117620:499211-499552 [Escherichia albertii]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGQLRRCHNTTAR
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGQLRRCHNTTAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|