Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 59371..59996 | Replicon | plasmid pEA25_1 |
| Accession | NZ_CP117616 | ||
| Organism | Escherichia albertii strain BIA_25 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A828AN07 |
| Locus tag | PS046_RS23590 | Protein ID | WP_059257082.1 |
| Coordinates | 59371..59769 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8H9EG71 |
| Locus tag | PS046_RS23595 | Protein ID | WP_000450526.1 |
| Coordinates | 59769..59996 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS046_RS23570 (PS046_23570) | 54481..56052 | - | 1572 | WP_273811869.1 | IS66 family transposase | - |
| PS046_RS23575 (PS046_23575) | 56072..56419 | - | 348 | WP_273813306.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS046_RS23580 (PS046_23580) | 56419..57096 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| PS046_RS23585 (PS046_23585) | 57173..59362 | + | 2190 | WP_273813308.1 | type IV conjugative transfer system coupling protein TraD | - |
| PS046_RS23590 (PS046_23590) | 59371..59769 | - | 399 | WP_059257082.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PS046_RS23595 (PS046_23595) | 59769..59996 | - | 228 | WP_000450526.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 / espL2 / espL2 / espL2 / gspG / gspH / gspL / vat | 1..100741 | 100741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14945.27 Da Isoelectric Point: 7.8605
>T271721 WP_059257082.1 NZ_CP117616:c59769-59371 [Escherichia albertii]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNIREFERMDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNIREFERMDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|